Antibodies

Jump to Filters
View as table Download
Pggt1b Rabbit Polyclonal Antibody
TA346734

USD 475.00

5 Days

Rabbit Polyclonal Anti-Pggt1b Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Pggt1b antibody is: synthetic peptide directed towards the C-terminal region of Rat Pggt1b. Synthetic peptide located within the following region: HAYFGICGLSLMEESGICKVHPALNVSTRTSERLRDLHQSWKTKDSKQCS