Rabbit Polyclonal Anti-UROD Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UROD antibody: synthetic peptide directed towards the N terminal of human UROD. Synthetic peptide located within the following region: SLLLLLFLFIVIFALLGMQLFGGRYDFEDTEVRRSNFDNFPQALISVFQV |
Rabbit anti-UROD Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human UROD |
Rabbit Polyclonal Anti-Urod Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Urod antibody is: synthetic peptide directed towards the N-terminal region of Rat Urod. Synthetic peptide located within the following region: AAQDFFSTCRSPEACCELTLQPLRRFPLDAAIIFSDILVVPQALGMEVTM |
Germany
Japan
United Kingdom
China
