Antibodies

View as table Download

Rabbit polyclonal anti-AGPAT5 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human AGPAT5.

Rabbit Polyclonal Anti-AGPAT5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AGPAT5 antibody: synthetic peptide directed towards the N terminal of human AGPAT5. Synthetic peptide located within the following region: RLLSAFLPARFYQALDDRLYCVYQSMVLFFFENYTGVQILLYGDLPKNKE

AGPAT5 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 120-320 of human AGPAT5 (NP_060831.2).
Modifications Unmodified