Antibodies

View as table Download

Rabbit polyclonal anti-ARMX3 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ARMX3.

Rabbit Polyclonal Anti-ARMX3 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-ARMX3 Antibody: A synthesized peptide derived from human ARMX3

Rabbit Polyclonal Anti-ARMCX3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ARMCX3 antibody: synthetic peptide directed towards the middle region of human ARMCX3. Synthetic peptide located within the following region: LFSAGNEETKLQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFNKKENKE

Rabbit Polyclonal Anti-ARMCX3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ARMCX3

ARMCX3 rabbit polyclonal antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ARMCX3

ARMCX3 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 40-140 of human ARMCX3 (NP_057691.1).
Modifications Unmodified