Rabbit polyclonal Anti-ATP6V0D2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATP6V0D2 antibody: synthetic peptide directed towards the middle region of human ATP6V0D2. Synthetic peptide located within the following region: MNVLAFNRQFHYGVFYAYVKLKEQEIRNIVWIAECISQRHRTKINSYIPI |
Rabbit polyclonal Anti-ATP6V0D2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATP6V0D2 antibody: synthetic peptide directed towards the middle region of human ATP6V0D2. Synthetic peptide located within the following region: GLRLLAQAEDFDQMKNVADHYGVYKPLFEAVGGSGGKTLEDVFYEREVQM |
ATP6V0D2 Antibody - middle region
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse ATP6V0D2 |
Germany
Japan
United Kingdom
China