Antibodies

Jump to Filters
View as table Download
CA5A Rabbit Polyclonal Antibody
TA372154

USD 380.00

4 Weeks

CA5A rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CA5A
CA5A Rabbit Polyclonal Antibody
TA313539

USD 345.00

In Stock

Rabbit polyclonal anti-CA5A antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CA5A.
CA5A Rabbit Polyclonal Antibody
TA342841

USD 375.00

5 Days

Rabbit Polyclonal Anti-CA5A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CA5A antibody: synthetic peptide directed towards the C terminal of human CA5A. Synthetic peptide located within the following region: PSQLSAFRTLLFSALGEEEKMMVNNYRPLQPLMNRKVWASFQATNEGTRS
CA5A Rabbit Polyclonal Antibody
TA342842

USD 375.00

5 Days

Rabbit Polyclonal Anti-CA5A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CA5A antibody: synthetic peptide directed towards the C terminal of human CA5A. Synthetic peptide located within the following region: AVIGVFLKLGAHHQTLQRLVDILPEIKHKDARAAMRPFDPSTLLPTCWDY
CA5A Rabbit Polyclonal Antibody
TA374173

USD 220.00

3 Weeks

CA5A Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 39-305 of human CA5A (NP_001730.1).
Modifications Unmodified