Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-CDO1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | CDO1 antibody was raised against a 19 amino acid peptide near the amino terminus of human CDO1. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-Cdo1 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Cdo1 antibody is: synthetic peptide directed towards the C-terminal region of Rat Cdo1. Synthetic peptide located within the following region: RTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPPFDTCHAFDQRTG |
Rabbit Polyclonal Anti-CDO1 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CDO1 |
CDO1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CDO1 |
CDO1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CDO1 |
CDO1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human CDO1 (NP_001792.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- CDO1
Clonalities
- Polyclonal