Antibodies

Jump to Filters
View as table Download
ELOF1 Rabbit Polyclonal Antibody
TA342951

USD 375.00

5 Days

Rabbit Polyclonal Anti-ELOF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ELOF1 antibody: synthetic peptide directed towards the middle region of human ELOF1. Synthetic peptide located within the following region: SCDVKMDRARNTGVISCTVCLEEFQTPITYLSEPVDVYSDWIDACEAANQ
ELOF1 Rabbit Polyclonal Antibody
TA357688

USD 360.00

5 Days

ELOF1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated