Antibodies

Jump to Filters
View as table Download
GDI2 (1-197) Rabbit Polyclonal Antibody
AP23171PU-N

USD 440.00

2 Weeks

GDI2 (1-197) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen Recombinant protein fragment containing a sequence corresponding to a region within amino acids 1 and 197 of Human Rho GDI2
GDI2 Rabbit Polyclonal Antibody
TA330442

USD 375.00

5 Days

Rabbit Polyclonal Anti-GDI2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GDI2 antibody: synthetic peptide directed towards the C terminal of human GDI2. Synthetic peptide located within the following region: EPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTESQIFISRTYDATTHF
GDI2 Rabbit Polyclonal Antibody
TA365851

USD 380.00

4 Weeks

GDI2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GDI2
GDI2 Rabbit Polyclonal Antibody
TA370192

USD 380.00

4 Weeks

GDI2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GDI2
GDI2 Rabbit Polyclonal Antibody
TA376534

USD 328.00

3 Weeks

GDI2 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 296-445 of human GDI2 (NP_001485.2).
Modifications Unmodified