Antibodies

Jump to Filters
View as table Download
GLT8D1 Rabbit Polyclonal Antibody
TA336120

USD 375.00

5 Days

Rabbit Polyclonal Anti-GLT8D1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GLT8D1 Antibody: synthetic peptide directed towards the middle region of human GLT8D1. Synthetic peptide located within the following region: LLIVFYQQHSTIDPMWNVRHLGSSAGKRYSPQFVKAAKLLHWNGHLKPWG
GLT8D1 Rabbit Polyclonal Antibody
TA366638

USD 380.00

4 Weeks

GLT8D1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GLT8D1
GLT8D1 Rabbit Polyclonal Antibody
TA370989

USD 380.00

4 Weeks

GLT8D1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GLT8D1