Antibodies

View as table Download

Rabbit Polyclonal Anti-GRHL3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GRHL3 antibody: synthetic peptide directed towards the C terminal of human GRHL3. Synthetic peptide located within the following region: EEVFDALMLKTPDLKGLRNAISEKYGFPEENIYKVYKKCKRGILVNMDNN

Rabbit Polyclonal Anti-GRHL3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GRHL3 antibody: synthetic peptide directed towards the C terminal of human GRHL3. Synthetic peptide located within the following region: EEVFDALMLKTPDLKGLRNAISEKYGFPEENIYKVYKKCKRGILVNMDNN

GRHL3 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human GRHL3 / SOM

Rabbit Polyclonal Anti-GRHL3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GRHL3 Antibody: synthetic peptide directed towards the C terminal of human GRHL3. Synthetic peptide located within the following region: SGVKGCLLSGFRGNETTYLRPETDLETPPVLFIPNVHFSSLQRSGGAAPS