Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-Hoxd4 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Hoxd4 antibody is: synthetic peptide directed towards the N-terminal region of Rat Hoxd4. Synthetic peptide located within the following region: FPPCEEYLQGGYLGEQGADYYGSGAQGSDFQPPGLYPRPDFGEQPFGGGG |
Rabbit Polyclonal Anti-HOXD4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HOXD4 antibody: synthetic peptide directed towards the C terminal of human HOXD4. Synthetic peptide located within the following region: RMKWKKDHKLPNTKGRSSSSSSSSSCSSSVAPSQHLQPMAKDHHTDLTTL |
HOXD4 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 194-223 amino acids from the C-terminal region of human HOXD4 / HOX4B |
Rabbit Polyclonal anti-HOXD4 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HOXD4 antibody: synthetic peptide directed towards the C terminal of human HOXD4. Synthetic peptide located within the following region: RMKWKKDHKLPNTKGRSSSSSSSSSCSSSVAPSQHLQPMAKDHHTDLTTL |
Active filters
Target Symbol
- HOXD4
Clonalities
- Polyclonal