HOXD4 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human HOXD4 |
HOXD4 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human HOXD4 |
Rabbit Polyclonal Anti-Hoxd4 Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Hoxd4 antibody is: synthetic peptide directed towards the N-terminal region of Rat Hoxd4. Synthetic peptide located within the following region: FPPCEEYLQGGYLGEQGADYYGSGAQGSDFQPPGLYPRPDFGEQPFGGGG |
Rabbit Polyclonal Anti-HOXD4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HOXD4 antibody: synthetic peptide directed towards the C terminal of human HOXD4. Synthetic peptide located within the following region: RMKWKKDHKLPNTKGRSSSSSSSSSCSSSVAPSQHLQPMAKDHHTDLTTL |
HOXD4 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 194-223 amino acids from the C-terminal region of human HOXD4 / HOX4B |
Rabbit Polyclonal anti-HOXD4 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HOXD4 antibody: synthetic peptide directed towards the C terminal of human HOXD4. Synthetic peptide located within the following region: RMKWKKDHKLPNTKGRSSSSSSSSSCSSSVAPSQHLQPMAKDHHTDLTTL |