Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-KCNG1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNG1 antibody: synthetic peptide directed towards the N terminal of human KCNG1. Synthetic peptide located within the following region: MTLLPGDNSDYDYSALSCTSDASFHPAFLPQRQAIKGAFYRRAQRLRPQD |
Rabbit Polyclonal Anti-KCNG1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNG1 antibody: synthetic peptide directed towards the N terminal of human KCNG1. Synthetic peptide located within the following region: YDVTCNEFFFDRNPGAFGTILTFLRAGKLRLLREMCALSFQEELLYWGIA |
Rabbit Polyclonal Anti-KCNG1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNG1 antibody: synthetic peptide directed towards the N terminal of human KCNG1. Synthetic peptide located within the following region: MTLLPGDNSDYDYSALSCTSDASFHPAFLPQRQAIKGAFYRRAQRLRPQD |
Rabbit Polyclonal Anti-KCNG1 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human KCNG1 |
Active filters
Target Symbol
- KCNG1
Clonalities
- Polyclonal