LRRC49 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human LRRC49 |
LRRC49 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human LRRC49 |
Rabbit Polyclonal Anti-LRRC49 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-LRRC49 antibody is: synthetic peptide directed towards the C-terminal region of Human LRRC49. Synthetic peptide located within the following region: YRLISILGDARKKQFRYLLESKGKKPGIINEENNDSKRLVGENTNRATLN |
Rabbit Polyclonal Anti-LRRC49 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LRRC49 antibody: synthetic peptide directed towards the N terminal of human LRRC49. Synthetic peptide located within the following region: KVEFKLNKDTSSFPGRLLQHDLERNYSSRQGDHINLVSSSLSSFPILQRS |
LRRC49 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human LRRC49 |