Antibodies

View as table Download

LRRC49 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human LRRC49

Rabbit Polyclonal Anti-LRRC49 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LRRC49 antibody is: synthetic peptide directed towards the C-terminal region of Human LRRC49. Synthetic peptide located within the following region: YRLISILGDARKKQFRYLLESKGKKPGIINEENNDSKRLVGENTNRATLN

Rabbit Polyclonal Anti-LRRC49 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LRRC49 antibody: synthetic peptide directed towards the N terminal of human LRRC49. Synthetic peptide located within the following region: KVEFKLNKDTSSFPGRLLQHDLERNYSSRQGDHINLVSSSLSSFPILQRS

LRRC49 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human LRRC49