LRRC6 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 186-215 amino acids from the Central region of human LRRC6 |
LRRC6 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 186-215 amino acids from the Central region of human LRRC6 |
Rabbit Polyclonal Anti-LRRC6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-LRRC6 Antibody: synthetic peptide directed towards the N terminal of human LRRC6. Synthetic peptide located within the following region: LNLALNNIEKIENLEGCEELAKLDLTVNFIGELSSIKNLQHNIHLKELFL |
Rabbit Polyclonal Anti-LRRC6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-LRRC6 Antibody: synthetic peptide directed towards the middle region of human LRRC6. Synthetic peptide located within the following region: MKTTSDRSREQTNTRSKHMEKLEVDPSKHSFPDVTNIVQEKKHTPRRRPE |