Rabbit Polyclonal Anti-CTAGE5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CTAGE5 antibody: synthetic peptide directed towards the middle region of human CTAGE5. Synthetic peptide located within the following region: LLEGPLRLSPLLPGGGGRGSRGPGNPLDHQITNERGESSCDRLTDPHRAP |
Rabbit Polyclonal Anti-CTAGE5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CTAGE5 antibody: synthetic peptide directed towards the N terminal of human CTAGE5. Synthetic peptide located within the following region: DEILCLEKELKEEKSKHSEQDELMADISKRIQSLEDESKSLKSQVAEAKM |
Rabbit Polyclonal Anti-CTAGE5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CTAGE5 antibody: synthetic peptide directed towards the middle region of human CTAGE5. Synthetic peptide located within the following region: PPRGFPPYLPPRPGFFPPPPHSEGRSEFPSGLIPPSNEPATEHPEPQQET |
Rabbit Polyclonal Anti-CTAGE5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CTAGE5 antibody: synthetic peptide directed towards the middle region of human CTAGE5. Synthetic peptide located within the following region: KLSKVDEKISHATEELETYRKRAKDLEEELERTIHSYQGQIISHEKKAHD |
Rabbit polyclonal anti-MIA2 antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MIA2. |
Rabbit Polyclonal Anti-MIA2 Antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | The immunogen for anti-MIA2 antibody: synthetic peptide directed towards the C terminal of human MIA2. Synthetic peptide located within the following region: NTKVMIFKSSYSLSDMVSNIELPTRIHEEVYFEPSSSKDSDENSKPSVDT |
MIA2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human CTAGE5 |
MIA2 Rabbit polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthesized peptide derived from MIA2 at AA range: 361-410 |
Germany
Japan
United Kingdom
China
