Antibodies

View as table Download

VAM1 (MPP6) (Center) rabbit polyclonal antibody, Purified

Applications FC, WB
Reactivities Human, Mouse
Immunogen Synthetic peptide - KLH conjugated - corresponding to the central region (between 367-396aa) of human MPP6 / MAGUK p55 subfamily member 6

Rabbit Polyclonal antibody to VAM1 (membrane protein, palmitoylated 6 (MAGUK p55 subfamily member 6))

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 1 and 44 of VAM1 (Uniprot ID#Q9NZW5)

Goat Polyclonal Antibody against MPP6

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence QQVLENLTELPSS-C, from the N Terminus of the protein sequence according to NP_057531.2.

Rabbit Polyclonal Anti-MPP6 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Mpp6 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Mpp6. Synthetic peptide located within the following region: TTVPFTSRKPREDEKDGQAYKFVSRSEMEADIKAGKYLEHGEYEGNLYGT

Rabbit Polyclonal Anti-MPP6 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human MPP6

MPP6 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human MPP6

MPP6 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human MPP6

MPP6 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 220-420 of human MPP6 (NP_057531.2).
Modifications Unmodified