Antibodies

Jump to Filters
View as table Download
MPST Rabbit Polyclonal Antibody
TA346634

USD 475.00

5 Days

Rabbit Polyclonal Anti-MPST Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-MPST antibody: synthetic peptide directed towards the middle region of human MPST. Synthetic peptide located within the following region: DPAFIKTYEDIKENLESRRFQVVDSRATGRFRGTEPEPRDGIEPGHIPGT
MPST Rabbit Polyclonal Antibody
TA378624

USD 220.00

3 Weeks

MPST Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 30-170 of human MPST (NP_066949.2).
Modifications Unmodified