Antibodies

Jump to Filters
View as table Download
OR5C1 Rabbit Polyclonal Antibody
TA337521

USD 375.00

5 Days

Rabbit Polyclonal Anti-OR5C1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR5C1 antibody is: synthetic peptide directed towards the C-terminal region of Human OR5C1. Synthetic peptide located within the following region: SSSYALDTDKMASVFYTLVIPSLNPLIYSLRNKEVKEALRQTWSRFHCPG