Rabbit Polyclonal Anti-OR5V1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR5V1 antibody is: synthetic peptide directed towards the C-terminal region of Human OR5V1. Synthetic peptide located within the following region: RPISTYSLKKDRLVSVLYSVVTPMLNPIIYTLRNKDIKEAVKTIGSKWQP |
Rabbit polyclonal anti-OR5V1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human OR5V1. |
Rabbit Polyclonal Anti-OR5V1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-OR5V1 antibody is: synthetic peptide directed towards the C-terminal region of Human OR5V1. Synthetic peptide located within the following region: VLSYICIISTILRIQSSEGRRKAFSTCASHLAIVFLFYGSAIFTYVRPIS |
Germany
Japan
United Kingdom
China