Antibodies

Jump to Filters
View as table Download
PCDHA5 (Center) Rabbit Polyclonal Antibody
AP53199PU-N

USD 450.00

2 Weeks

PCDHA5 (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 294-323 amino acids from the Central region of human PCDHA5
PCDHA5 Rabbit Polyclonal Antibody
TA331059

USD 375.00

5 Days

Rabbit polyclonal Anti-PCDHA5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PCDHA5 antibody: synthetic peptide directed towards the N terminal of human PCDHA5. Synthetic peptide located within the following region: VYSRRGSLGSRLLLLWLLLAYWKAGSGQLHYSIPEEAKHGTFVGRIAQDL