Antibodies

Jump to Filters
View as table Download
PPWD1 Rabbit Polyclonal Antibody
TA333825

USD 375.00

5 Days

Rabbit Polyclonal Anti-PPWD1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PPWD1 Antibody: synthetic peptide directed towards the middle region of human PPWD1. Synthetic peptide located within the following region: FMIQTGDPTGTGMGGESIWGGEFEDEFHSTLRHDRPYTLSMANAGSNTNG
PPWD1 Rabbit Polyclonal Antibody
TA380281

USD 220.00

3 Weeks

PPWD1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human PPWD1.