Antibodies

View as table Download

Rabbit Polyclonal Anti-Choline Transporter (CHT) (extracellular)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)DWNQTAYGYPDPK, corresponding to amino acid residues 299-311 of mouse Choline Transporter. 4th extracellular loop.

Rabbit Polyclonal Anti-SLC5A7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC5A7 Antibody: synthetic peptide directed towards the middle region of human SLC5A7. Synthetic peptide located within the following region: DDNGIYNQKFPFKTLAMVTSFLTNICISYLAKYLFESGTLPPKLDVFDAV

Rabbit Polyclonal Anti-SLC5A7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC5A7 Antibody is: synthetic peptide directed towards the C-terminal region of Human SLC5A7. Synthetic peptide located within the following region: ILVKNENIKLDELALVKPRQSMTLSSTFTNKEAFLDVDSSPEGSGTEDNL

SLC5A7 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 421-580 of human SLC5A7 (NP_068587.1).
Modifications Unmodified