Antibodies

Jump to Filters
View as table Download
SMG5 Rabbit Polyclonal Antibody
TA333828

USD 375.00

In Stock

Rabbit Polyclonal Anti-SMG5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SMG5 Antibody: synthetic peptide directed towards the N terminal of human SMG5. Synthetic peptide located within the following region: MSQGPPTGESSEPEAKVLHTKRLYRAVVEAVHRLDLILCNKTAYQEVFKP
SMG5 Rabbit Polyclonal Antibody
TA381778

USD 220.00

3 Weeks

SMG5 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SMG5.