Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-SFRS7 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SFRS7. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-SFRS7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SFRS7 Antibody: synthetic peptide directed towards the N terminal of human SFRS7. Synthetic peptide located within the following region: MSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFA |
Rabbit Polyclonal Anti-SFRS7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SFRS7 Antibody: synthetic peptide directed towards the middle region of human SFRS7. Synthetic peptide located within the following region: SRSGSIKGSRYFQSPSRSRSRSRSISRPRSSRSKSRSPSPKRSRSPSGSP |
SRSF7 Antibody - C-terminal
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human SRSF7 |
SRSF7 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 60-120 of human SRSF7 (NP_001026854). |
| Modifications | Unmodified |
Active filters
Target Symbol
- SRSF7
Clonalities
- Polyclonal