Goat Polyclonal Antibody against TGIF2
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-EMELQKQQDP, from the internal region of the protein sequence according to NP_068581.1. |
Goat Polyclonal Antibody against TGIF2
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-EMELQKQQDP, from the internal region of the protein sequence according to NP_068581.1. |
Rabbit Polyclonal Anti-RGD1564927 Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-RGD1564927 antibody is: synthetic peptide directed towards the C-terminal region of Rat RGD1564927. Synthetic peptide located within the following region: PPPTPPEQDKDDFSSFQLLVEVALQRAAEMELQKQQDPAPPLLHTPLPLV |
Rabbit Polyclonal TGF beta induced factor 2 Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit polyclonal TGIF2 Antibody (C-term)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This TGIF2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 171-199 amino acids from the C-terminal region of human TGIF2. |
Rabbit polyclonal antibody to TGF beta induced factor 2 (TGFB-induced factor homeobox 2)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 161 and 237 of TGF beta induced factor 2 |
Rabbit Polyclonal Anti-Tgif2 Antibody
Applications | WB |
Reactivities | Rat |
Immunogen | The immunogen for Anti-Tgif2 Antibody is: synthetic peptide directed towards the N-terminal region of RAT Tgif2. Synthetic peptide located within the following region: SDSDLGEDEGLLSLTGKRKRRGNLPKESVKILRDWLYLHRYNAYPSEQEK |