Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-TLE2 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TLE2. |
Antibodies
View as table Download
TLE2 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 636-665 amino acids from the C-terminal region of human TLE2 |
Rabbit Polyclonal Anti-TLE2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TLE2 antibody: synthetic peptide directed towards the N terminal of human TLE2. Synthetic peptide located within the following region: VEEERPSGPGGGGKQRADEKEPSGPYESDEDKSDYNLVVDEDQPSEPPSP |
Active filters
Target Symbol
- TLE2
Clonalities
- Polyclonal