Antibodies

View as table Download

Rabbit Polyclonal Anti-TNNT3

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TNNT3 antibody: synthetic peptide directed towards the C terminal of human TNNT3. Synthetic peptide located within the following region: QLEIDKFEFGEKLKRQKYDIMNVRARVQMLAKFSKKAGTPAKGKVGGRWK

Rabbit Polyclonal Anti-TNNT3

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TNNT3 antibody: synthetic peptide directed towards the N terminal of human TNNT3. Synthetic peptide located within the following region: PRPKLTAPKIPEGEKVDFDDIQKKRQNKDLMELQALIDSHFEARKKEEEE

TNNT3 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 147-256 of human TNNT3 (NP_001036246.1).
Modifications Unmodified