Antibodies

Jump to Filters
View as table Download
Ube2h Rabbit Polyclonal Antibody
TA329561

USD 375.00

5 Days

Rabbit Polyclonal anti-Ube2h Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Ube2h antibody is: synthetic peptide directed towards the N-terminal region of Mouse Ube2h. Synthetic peptide located within the following region: PSPGKRRMDTDVVKLIESKHEVTILGGLNEFVVKFYGPQGTPYEGGVWKV
UBE2H Rabbit Polyclonal Antibody
TA383013

USD 220.00

3 Weeks

UBE2H Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-183 of human UBE2H (NP_003335.1).
Modifications Unmodified