Antibodies

View as table Download

Rabbit Polyclonal Anti-ULBP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ULBP1 antibody: synthetic peptide directed towards the N terminal of human ULBP1. Synthetic peptide located within the following region: MAAAASPAFLLCLPLLHLLSGWSRAGWVDTHCLCYDFIITPKSRPEPQWC

Rabbit Polyclonal Anti-ULBP1 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human ULBP1

ULBP1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 26-216 of human ULBP1 (NP_079494.1).
Modifications Unmodified