Rabbit Polyclonal Unc93b Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Unc93b antibody was raised against a 19 amino acid peptide from near the amino terminus of human Unc93b. |
Rabbit Polyclonal Unc93b Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Unc93b antibody was raised against a 19 amino acid peptide from near the amino terminus of human Unc93b. |
UNC93B (UNC93B1) (N-term) rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | UNC93B antibody was raised against 19 amino acid peptide from near the amino terminus of human Unc93b |
Rabbit Polyclonal Anti-UNC93B1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UNC93B1 antibody: synthetic peptide directed towards the N terminal of human UNC93B1. Synthetic peptide located within the following region: LKNVLAASAGGMLTYGVYLGLLQMQLILHYDETYREVKYGNMGLPDIDSK |
Rabbit Polyclonal UNC93B Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A portion of amino acid 500-550 of mouse UNC93B protein was used as the immunogen. |
UNC93B1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human UNC93B1 |
UNC93B1 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 450-550 of human UNC93B1 (NP_112192.2). |
Modifications | Unmodified |