Rabbit Polyclonal Anti-VCY Antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | The immunogen for anti-VCY antibody is: synthetic peptide directed towards the N-terminal region of Human VCY. Synthetic peptide located within the following region: PPAKAKETGKRKSSSQPSPSGPKKKTTKVAEKGEAVRGGRRGKKGAATKM |
Rabbit Polyclonal Anti-VCY Antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | The immunogen for anti-VCY antibody is: synthetic peptide directed towards the N-terminal region of Human VCY. Synthetic peptide located within the following region: RKSSSQPSPSGPKKKTTKVAEKGEAVRGGRRGKKGAATKMAAVTAPEAES |
Germany
Japan
United Kingdom
China