Antibodies

Jump to Filters
View as table Download
KDEL Receptor (KDELR1) Mouse Monoclonal Antibody [Clone ID: KR-10]
TA309411

USD 395.00

2 Weeks

Mouse Monoclonal anti-KDELR1 Antibody

Applications IF, WB
Reactivities Human, Monkey, Rat, Mouse, Hamster, Rabbit, Porcine, Bovine, Sheep, Dog, Chicken, Drosophilia, Xenopus
Conjugation Unconjugated
KCNQ1 Rabbit Polyclonal Antibody
TA337729

USD 375.00

5 Days

Rabbit Polyclonal Anti-KCNQ1 Antibody

Applications IHC, WB
Reactivities Hamster, Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNQ1 antibody: synthetic peptide directed towards the N terminal of human KCNQ1. Synthetic peptide located within the following region: RSKYVGLWGRLRFARKPISIIDLIVVVASMVVLCVGSKGQVFATSAIRGI
KCNQ1 Rabbit Polyclonal Antibody
TA338784

USD 310.00

5 Days

Rabbit Polyclonal Anti-KCNQ1 Antibody

Applications WB
Reactivities Hamster, Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNQ1 antibody: synthetic peptide directed towards the N terminal of human KCNQ1. Synthetic peptide located within the following region: IVVVASMVVLCVGSKGQVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGS