CD40L Capture mouse monoclonal antibody, ELISA and Luminex validated, clone MK13A4
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700027 |
CD40L Capture mouse monoclonal antibody, ELISA and Luminex validated, clone MK13A4
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700027 |
Rabbit Polyclonal Anti-CD40LG Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD40LG antibody: synthetic peptide directed towards the middle region of human CD40LG. Synthetic peptide located within the following region: ENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLEN |
Mouse Anti-Human CD154 (CD40 Ligand) Purified (25 ug)
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit anti CD154 Polyclonal Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to aa 51-69 of human CD154. |
Rabbit Polyclonal Anti-CD40LG Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CD40LG |