Antibodies

Jump to Filters
View as table Download
CHIC2 Rabbit Polyclonal Antibody
TA341896

USD 375.00

5 Days

Rabbit Polyclonal Anti-CHIC2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHIC2 antibody: synthetic peptide directed towards the N terminal of human CHIC2. Synthetic peptide located within the following region: EEQLLKYSPDPVVVRGSGHVTVFGLSNKFESEFPSSLTGKVAPEEFKASI
CHIC2 Rabbit Polyclonal Antibody
TA341897

USD 375.00

5 Days

Rabbit Polyclonal Anti-CHIC2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHIC2 antibody: synthetic peptide directed towards the N terminal of human CHIC2. Synthetic peptide located within the following region: MADFDEIYEEEEDEERALEEQLLKYSPDPVVVRGSGHVTVFGLSNKFESE