Antibodies

View as table Download

Rabbit Polyclonal XPD Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit Polyclonal Anti-ERCC2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ERCC2 antibody: synthetic peptide directed towards the N terminal of human ERCC2. Synthetic peptide located within the following region: KLNVDGLLVYFPYDYIYPEQFSYMRELKRTLDAKGHGVLEMPSGTGKTVS

Carrier-free (BSA/glycerol-free) ERCC2 mouse monoclonal antibody, clone OTI4B11 (formerly 4B11)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ERCC2 mouse monoclonal antibody, clone OTI4B11 (formerly 4B11)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ERCC2 mouse monoclonal antibody, clone OTI4B11 (formerly 4B11)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated