Antibodies

View as table Download

Rabbit polyclonal anti-GIPR antibody

Applications IF, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GIPR.

Rabbit polyclonal GIPR Antibody (N-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This GIPR antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 7-38 amino acids from the N-terminal region of human GIPR.

Rabbit Polyclonal Anti-GIPR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GIPR antibody is: synthetic peptide directed towards the N-terminal region of Human GIPR. Synthetic peptide located within the following region: LRLSLCGLLLQRAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSVAA

Rabbit Polyclonal Anti-GIPR Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GIPR