Rabbit polyclonal anti-NLE1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NLE1. |
Rabbit polyclonal anti-NLE1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NLE1. |
Rabbit Polyclonal Anti-NLE1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NLE1 antibody is: synthetic peptide directed towards the C-terminal region of Human NLE1. Synthetic peptide located within the following region: DSTLKVWDVKAQKLAMDLPGHADEVYAVDWSPDGQRVASGGKDKCLRIWR |