Antibodies

View as table Download

Rabbit Polyclonal Anti-NR6A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR6A1 antibody: synthetic peptide directed towards the N terminal of human NR6A1. Synthetic peptide located within the following region: FCQDELAELDPGTISVSDDRAEQRTCLICGDRATGLHYGIISCEGCKGFF

Carrier-free (BSA/glycerol-free) NR6A1 mouse monoclonal antibody,clone OTI6F3

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

NR6A1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human NR6A1

NR6A1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human NR6A1

NR6A1 mouse monoclonal antibody,clone OTI6F3

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

NR6A1 mouse monoclonal antibody,clone OTI6F3

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated