Mouse Monoclonal Rad51D Antibody (5B3/6)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal Rad51D Antibody (5B3/6)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-RAD51D Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RAD51D antibody is: synthetic peptide directed towards the C-terminal region of Human RAD51D. Synthetic peptide located within the following region: RLKPALGRSWSFVPSTRILLDTIEGAGASGGRRMACLAKSSRQPTGFQEM |
RAD51L3 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |