RBBP7 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI2D8
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700050 |
RBBP7 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI2D8
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700050 |
RBBP7 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI4C9
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700050 |
Rabbit polyclonal Anti-RBBP7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RBBP7 antibody: synthetic peptide directed towards the N terminal of human RBBP7. Synthetic peptide located within the following region: MTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVH |
Rabbit polyclonal Anti-RBBP7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RBBP7 antibody: synthetic peptide directed towards the middle region of human RBBP7. Synthetic peptide located within the following region: HWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGH |
Carrier-free (BSA/glycerol-free) RBBP7 mouse monoclonal antibody, clone OTI5A4 (formerly 5A4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RBBP7 mouse monoclonal antibody, clone OTI4C9 (formerly 4C9)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RBBP7 mouse monoclonal antibody, clone OTI3A12 (formerly 3A12)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RBBP7 mouse monoclonal antibody, clone OTI2D8 (formerly 2D8)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RBBP7 (RbAp46) mouse monoclonal antibody, clone OTI5A4 (formerly 5A4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RBBP7 (RbAp46) mouse monoclonal antibody, clone OTI5A4 (formerly 5A4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RBBP7 (RbAp46) mouse monoclonal antibody, clone OTI4C9 (formerly 4C9)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RBBP7 (RbAp46) mouse monoclonal antibody, clone OTI4C9 (formerly 4C9)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RBBP7 (RbAp46) mouse monoclonal antibody, clone OTI3A12 (formerly 3A12)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RBBP7 (RbAp46) mouse monoclonal antibody, clone OTI3A12 (formerly 3A12)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RBBP7 (RbAp46) mouse monoclonal antibody, clone OTI2D8 (formerly 2D8)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RBBP7 (RbAp46) mouse monoclonal antibody, clone OTI2D8 (formerly 2D8)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |