Rabbit Monoclonal antibody against Stanniocalcin-1 (STC1)
Applications | Assay, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Monoclonal antibody against Stanniocalcin-1 (STC1)
Applications | Assay, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-STC1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-STC1 antibody: synthetic peptide directed towards the N terminal of human STC1. Synthetic peptide located within the following region: MLQNSAVLLVLVISASATHEAEQNDSVSPRKSRVAAQNSAEVVRCLNSAL |
Carrier-free (BSA/glycerol-free) STC1 mouse monoclonal antibody,clone OTI1E9
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) STC1 mouse monoclonal antibody,clone OTI6D12
Applications | WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-STC1 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human STC1 |
STC1 mouse monoclonal antibody,clone OTI1E9
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
STC1 mouse monoclonal antibody,clone OTI1E9
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
STC1 mouse monoclonal antibody,clone OTI6D12
Applications | WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
STC1 mouse monoclonal antibody,clone OTI6D12
Applications | WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |