Antibodies

View as table Download

Rabbit Polyclonal Anti-PAX7 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PAX7 antibody: synthetic peptide directed towards the N terminal of human PAX7. Synthetic peptide located within the following region: KEEEDEADKKEDDGEKKAKHSIDGILGDKGNRLDEGSDVESEPDLPLKRK

Rabbit Polyclonal Anti-PAX7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PAX7 antibody: synthetic peptide directed towards the middle region of human PAX7. Synthetic peptide located within the following region: KPGDSLPTSQAYCPPTYSTTGYSVDPVAGYQYGQYGQSECLVPWASPVPI

Rabbit Polyclonal Anti-PAX7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PAX7 antibody: synthetic peptide directed towards the N terminal of human PAX7. Synthetic peptide located within the following region: CDRSTVPSGLVSSISRVLRIKFGKKEEEDEADKKEDDGEKKAKHSIDGIL

Rabbit Polyclonal Anti-PAX7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PAX7 antibody is: synthetic peptide directed towards the C-terminal region of PAX7. Synthetic peptide located within the following region: QADFSISPLHGGLDSATSISASCSQRADSIKPGDSLPTSQAYCPPTYSTT

Carrier-free (BSA/glycerol-free) PAX7 mouse monoclonal antibody,clone OTI4A7

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PAX7 mouse monoclonal antibody,clone OTI4G5

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-PAX7 Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 245 amino acids of human paired box 7

PAX7 mouse monoclonal antibody,clone OTI4A7

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PAX7 mouse monoclonal antibody,clone OTI4A7

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PAX7 mouse monoclonal antibody,clone OTI4G5

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PAX7 mouse monoclonal antibody,clone OTI4G5

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated