Rabbit polyclonal anti-GPR173 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GPR173. |
Rabbit polyclonal anti-GPR173 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GPR173. |
Rabbit polyclonal anti-GPR173 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GPR173. |
Rabbit Polyclonal Anti-GPR173 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GPR173 Antibody is: synthetic peptide directed towards the C-terminal region of Human GPR173. Synthetic peptide located within the following region: IRQNGHAASRRLLGMDEVKGEKQLGRMFYAITLLFLLLWSPYIVACYWRV |
Rabbit Polyclonal Anti-GPR173 Antibody (N-Terminus)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | GPR173 / SREB3 antibody was raised against synthetic 19 amino acid peptide from N-terminal extracellular domain of human GPR173. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Elephant, Panda, Dog, Bat, Rabbit (100%); Mouse, Rat, Hamster, Bovine (95%). |
Rabbit Polyclonal Anti-GPR173 Antibody (Transmembrane Domain)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | GPR173 / SREB3 antibody was raised against synthetic 19 amino acid peptide from 5th transmembrane domain of human GPR173. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bat, Bovine, Rabbit (100%); Opossum (95%). |