Rabbit Polyclonal BMP-2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal region of human BMP2 (within residues 250-350) [Swiss-Prot# P12643] |
Rabbit Polyclonal BMP-2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal region of human BMP2 (within residues 250-350) [Swiss-Prot# P12643] |
Rabbit Polyclonal Anti-BMP6 Antibody - middle region
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-BMP6 antibody: synthetic peptide directed towards the middle region of human BMP6. Synthetic peptide located within the following region: MVAFFKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVARVSSASDYNSSEL |
Rabbit polyclonal anti-BMP-6 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | E. coli expressed recombinant human BMP-6 |
Rabbit Polyclonal Anti-BMP5 Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Bmp5 antibody is: synthetic peptide directed towards the C-terminal region of Rat Bmp5. Synthetic peptide located within the following region: NKSSSHQDPSRIPSAGDYNTSEQKQACKKHELYVSFRDLGWQDWIIAPEG |
Rabbit anti-BMP7 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human BMP7 |
Carrier-free (BSA/glycerol-free) BMP4 mouse monoclonal antibody, clone OTI6B7 (formerly 6B7)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BMP4 mouse monoclonal antibody,clone OTI1C2
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BMP4 mouse monoclonal antibody,clone OTI1D1
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BMP6 mouse monoclonal antibody,clone OTI1B11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BMP6 mouse monoclonal antibody,clone OTI4A3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BMP6 mouse monoclonal antibody,clone OTI8B11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BMP6 mouse monoclonal antibody,clone OTI6G9
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-BMP4 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 293-408 amino acids of human bone morphogenetic protein 4 |
Anti-BMP4 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 293-408 amino acids of human bone morphogenetic protein 4 |
Rabbit Polyclonal Anti-BMP6 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human BMP6 |
Anti-BMP4 mouse monoclonal antibody, clone OTI6B7 (formerly 6B7)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-BMP4 mouse monoclonal antibody, clone OTI6B7 (formerly 6B7)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
BMP4 mouse monoclonal antibody,clone OTI1C2
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
BMP4 mouse monoclonal antibody,clone OTI1C2
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
BMP4 mouse monoclonal antibody,clone OTI1D1
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
BMP4 mouse monoclonal antibody,clone OTI1D1
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
BMP6 mouse monoclonal antibody,clone OTI1B11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
BMP6 mouse monoclonal antibody,clone OTI1B11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
BMP6 mouse monoclonal antibody,clone OTI4A3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
BMP6 mouse monoclonal antibody,clone OTI4A3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
BMP6 mouse monoclonal antibody,clone OTI8B11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
BMP6 mouse monoclonal antibody,clone OTI8B11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
BMP6 mouse monoclonal antibody,clone OTI6G9
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
BMP6 mouse monoclonal antibody,clone OTI6G9
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal anti-BMP2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human BMP2 |
Rabbit polyclonal anti-BMP2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human BMP2 |
BMP4 mouse monoclonal antibody,clone UMAB42
Applications | 10k-ChIP, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) BMP4 mouse monoclonal antibody,clone UMAB42
Applications | 10k-ChIP, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
BMP4 mouse monoclonal antibody,clone UMAB42
Applications | 10k-ChIP, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |