Antibodies

Jump to Filters
View as table Download
DLX3 Rabbit Polyclonal Antibody
TA313754

USD 345.00

In Stock

Rabbit polyclonal anti-DLX3 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human DLX3.
DLX3 Rabbit Polyclonal Antibody
TA313755

USD 345.00

In Stock

Rabbit polyclonal anti-COX7S/A2 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human COX7S/A2.
DLX3 Rabbit Polyclonal Antibody
TA347544

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-DLX3 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-DLX3 Antibody: A synthesized peptide derived from human DLX3
DLX3 Rabbit Polyclonal Antibody
TA330203

USD 375.00

5 Days

Rabbit Polyclonal Anti-DLX3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DLX3 antibody: synthetic peptide directed towards the N terminal of human DLX3. Synthetic peptide located within the following region: SSILTDISSSLSCHAGSKDSPTLPESSVTDLGYYSAPQHDYYSGQPYGQT
DLX3 Rabbit Polyclonal Antibody
TA329350

USD 375.00

5 Days

Rabbit Polyclonal anti-DLX3 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DLX3 antibody: synthetic peptide directed towards the N terminal of human DLX3. Synthetic peptide located within the following region: LAGTGAYSPKSEYTYGASYRQYGAYREQPLPAQDPVSVKEEPEAEVRMVN
DLX3 Rabbit Polyclonal Antibody
TA343516

USD 310.00

5 Days

Rabbit Polyclonal Anti-DLX3 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-DLX3 antibody: synthetic peptide directed towards the C terminal of human DLX3. Synthetic peptide located within the following region: SASPSYLDDPTNSWYHAQNLSGPHLQQQPPQPATLHHASPGPPPNPGAVY