Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-CYB5R1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CYB5R1. |
Antibodies
View as table Download
Rabbit polyclonal antibody to b5R.1 (cytochrome b5 reductase 1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 275 of b5R.1 (Uniprot ID#Q9UHQ9) |
Rabbit polyclonal antibody to Chitotriosidase (chitinase 1 (chitotriosidase))
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 216 and 463 of Chitotriosidase (Uniprot ID#Q13231) |
Goat Polyclonal Antibody against CHIT1 (aa409-423)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence EHGPSPGQDTFCQGK, from the internal region (near C Terminus) of the protein sequence according to NP_003456.1. |
Rabbit Polyclonal Anti-UXS1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UXS1 antibody: synthetic peptide directed towards the middle region of human UXS1. Synthetic peptide located within the following region: LMLGWEPVVPLEEGLNKAIHYFRKELEYQANNQYIPKPKPARIKKGRTRH |
CYB5R1 mouse monoclonal antibody, clone OTI4B7 (formerly 4B7)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
CYB5R1 mouse monoclonal antibody, clone OTI5G9 (formerly 5G9)
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
CYB5R1 mouse monoclonal antibody, clone OTI3G2 (formerly 3G2)
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
CYB5R1 mouse monoclonal antibody, clone OTI2D10 (formerly 2D10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Conjugates
- Unconjugated
Families
- Transmembrane
Pathways
- Amino sugar and nucleotide sugar metabolism