Germany
Japan
United Kingdom
China
Rabbit anti-FMO3 Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human FMO3 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-FMO3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FMO3 antibody: synthetic peptide directed towards the N terminal of human FMO3. Synthetic peptide located within the following region: MGKKVAIIGAGVSGLASIRSCLEEGLEPTCFEKSNDIGGLWKFSDHAEEG |
Rabbit Polyclonal Anti-FMO3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FMO3 antibody: synthetic peptide directed towards the N terminal of human FMO3. Synthetic peptide located within the following region: FMHNSKIQEYIIAFAKEKNLLKYIQFKTFVSSVNKHPDFATTGQWDVTTE |
Carrier-free (BSA/glycerol-free) FMO3 mouse monoclonal antibody,clone OTI1G3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
FMO3 mouse monoclonal antibody, clone OTI3H1 (formerly 3H1)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
FMO3 mouse monoclonal antibody,clone OTI1G3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
FMO3 mouse monoclonal antibody,clone OTI1G3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
FMO3 mouse monoclonal antibody,clone OTI1G4
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Target Symbol
- FMO3
Conjugates
- Unconjugated
Families
- Transmembrane
Pathways
- Drug metabolism - cytochrome P450