Antibodies

Jump to Filters
View as table Download
PSGR (OR51E2) Rabbit Polyclonal Antibody
TA337961

USD 375.00

5 Days

Rabbit Polyclonal Anti-OR51E2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OR51E2 antibody is: synthetic peptide directed towards the C-terminal region of Human OR51E2. Synthetic peptide located within the following region: VRVVMGDIYLLLPPVINPIIYGAKTKQIRTRVLAMFKISCDKDLQAVGGK
PSGR (OR51E2) Rabbit Polyclonal Antibody
TA340968

USD 425.00

2 Weeks

Rabbit Polyclonal Anti-OR51E2 Antibody (N-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen OR51E2 / PSGR antibody was raised against synthetic 14 amino acid peptide from N-terminal extracellular domain of human OR51E2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Galago, Marmoset, Hamster, Bat, Rabbit, Pig (100%); Mouse, Rat, Elephant, Panda, Bovine (93%); Horse (86%).
OR10G7 Rabbit Polyclonal Antibody
TA316436

USD 345.00

4 Weeks

Rabbit polyclonal anti-OR10G7 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR10G7.
OR10H1 Rabbit Polyclonal Antibody
TA315333

USD 345.00

In Stock

Rabbit polyclonal anti-OR10H1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR10H1.
OR2B11 Rabbit Polyclonal Antibody
TA337489

USD 375.00

5 Days

Rabbit Polyclonal Anti-OR2B11 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR2B11 antibody is: synthetic peptide directed towards the C-terminal region of Human OR2B11. Synthetic peptide located within the following region: LLSYGFIARAVLRIQSSKGRHKAFGTCSSHLMIVSLFYLPAIYMYLQPPS
GPR 164 (OR51E1) Rabbit Polyclonal Antibody
TA312480

USD 345.00

In Stock

Rabbit polyclonal anti-OR51E1 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR51E1.
OR1D2 Rabbit Polyclonal Antibody
TA314306

USD 345.00

In Stock

Rabbit polyclonal anti-OR1D2 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR1D2.
OR1A1 Rabbit Polyclonal Antibody
TA314742

USD 345.00

In Stock

Rabbit polyclonal anti-OR1A1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human OR1A1.
OR52A1 Rabbit Polyclonal Antibody
TA315253

USD 345.00

In Stock

Rabbit polyclonal anti-OR52A1 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR52A1.
OR5K1 Rabbit Polyclonal Antibody
TA315325

USD 345.00

In Stock

Rabbit polyclonal anti-OR5K1 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR5K1.
OR4F4 Rabbit Polyclonal Antibody
TA315342

USD 345.00

In Stock

Rabbit polyclonal anti-OR4F4 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human OR4F4.
OR4D1 Rabbit Polyclonal Antibody
TA315345

USD 345.00

In Stock

Rabbit polyclonal anti-OR4D1 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human OR4D1.
OR2T1 Rabbit Polyclonal Antibody
TA315346

USD 345.00

In Stock

Rabbit polyclonal anti-OR2T1 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR2T1.
OR2J2 Rabbit Polyclonal Antibody
TA315347

USD 345.00

In Stock

Rabbit polyclonal anti-OR2J2 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human OR2J2.
OR51B2 Rabbit Polyclonal Antibody
TA315782

USD 345.00

In Stock

Rabbit polyclonal anti-OR51B2 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR51B2.
OR4C15 Rabbit Polyclonal Antibody
TA315846

USD 345.00

In Stock

Rabbit polyclonal anti-OR4C15 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human OR4C15.
OR4A16 Rabbit Polyclonal Antibody
TA315847

USD 345.00

In Stock

Rabbit polyclonal anti-OR4A16 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR4A16.
OR4A15 Rabbit Polyclonal Antibody
TA315848

USD 345.00

In Stock

Rabbit polyclonal anti-OR4A15 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human OR4A15.
OR2G3 Rabbit Polyclonal Antibody
TA315852

USD 345.00

In Stock

Rabbit polyclonal anti-OR2G3 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR2G3.
OR2B2 Rabbit Polyclonal Antibody
TA315858

USD 345.00

In Stock

Rabbit polyclonal anti-OR2B2 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR2B2.
OR12D3 Rabbit Polyclonal Antibody
TA315861

USD 345.00

In Stock

Rabbit polyclonal anti-OR10D4 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR10D4.
OR4L1 Rabbit Polyclonal Antibody
TA316064

USD 345.00

In Stock

Rabbit polyclonal anti-OR4L1 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human OR4L1.
OR10H4 Rabbit Polyclonal Antibody
TA316079

USD 345.00

In Stock

Rabbit polyclonal anti-OR10H4 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR10H4.
OR2T11 Rabbit Polyclonal Antibody
TA316083

USD 345.00

In Stock

Rabbit polyclonal anti-OR2T11 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR2T11.
Olfactory receptor 10X1 (OR10X1) Rabbit Polyclonal Antibody
TA316090

USD 345.00

In Stock

Rabbit polyclonal anti-OR10X1 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR10X1.
OR10Z1 Rabbit Polyclonal Antibody
TA316091

USD 345.00

In Stock

Rabbit polyclonal anti-OR10Z1 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR10Z1.
OR13C4 Rabbit Polyclonal Antibody
TA316117

USD 345.00

In Stock

Rabbit polyclonal anti-OR13C4 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR13C4.
OR56B4 Rabbit Polyclonal Antibody
TA316210

USD 345.00

In Stock

Rabbit polyclonal anti-OR56B4 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR56B4.
OR4C6 Rabbit Polyclonal Antibody
TA316227

USD 345.00

In Stock

Rabbit polyclonal anti-OR4C6 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR4C6.
OR10S1 Rabbit Polyclonal Antibody
TA316237

USD 345.00

In Stock

Rabbit polyclonal anti-OR10S1 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR10S1.
OR9Q1 Rabbit Polyclonal Antibody
TA316241

USD 345.00

In Stock

Rabbit polyclonal anti-OR9Q1 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR9Q1.
OR4C3 Rabbit Polyclonal Antibody
TA316273

USD 345.00

In Stock

Rabbit polyclonal anti-OR4C3 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR4C3.
OR10AG1 Rabbit Polyclonal Antibody
TA316295

USD 345.00

In Stock

Rabbit polyclonal anti-OR10AG1 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR10AG1.
OR8B4 Rabbit Polyclonal Antibody
TA316301

USD 345.00

In Stock

Rabbit polyclonal anti-OR8B4 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human OR8B4.
OR2AG2 Rabbit Polyclonal Antibody
TA316343

USD 345.00

In Stock

Rabbit polyclonal OR2AG1/2AG2 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR2AG1/2AG2.
OR51B6 Rabbit Polyclonal Antibody
TA316407

USD 345.00

In Stock

Rabbit polyclonal anti-OR51B6 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR51B6.
OR52D1 Rabbit Polyclonal Antibody
TA316411

USD 345.00

In Stock

Rabbit polyclonal anti-OR52D1 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR52D1.
OR52E4 Rabbit Polyclonal Antibody
TA316414

USD 345.00

In Stock

Rabbit polyclonal anti-OR52E4 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR52E4.
OR4X1 Rabbit Polyclonal Antibody
TA316417

USD 345.00

In Stock

Rabbit polyclonal anti-OR4X1 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human OR4X1.
OR10V1 Rabbit Polyclonal Antibody
TA316431

USD 345.00

In Stock

Rabbit polyclonal anti-OR10V1 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR10V1.
OR1L6 Rabbit Polyclonal Antibody
TA316451

USD 345.00

In Stock

Rabbit polyclonal anti-OR1L6 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR1L6.
OR2A7 Rabbit Polyclonal Antibody
TA316453

USD 345.00

In Stock

Rabbit polyclonal anti-OR2A4/2A7 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR2A4/2A7.
OR51A4 Rabbit Polyclonal Antibody
TA316455

USD 345.00

In Stock

Rabbit polyclonal anti-OR51A4 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR51A4.
OR2T2 Rabbit Polyclonal Antibody
TA316458

USD 345.00

In Stock

Rabbit polyclonal OR2T2/2T35 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR2T2.
OR2G2 Rabbit Polyclonal Antibody
TA326149

USD 345.00

In Stock

Rabbit polyclonal OR2G2 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR2G2.
Olfactory receptor 10X1 (OR10X1) Rabbit Polyclonal Antibody
TA344311

USD 475.00

5 Days

Rabbit Polyclonal Anti-OR10X1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OR10X1 antibody: synthetic peptide directed towards the middle region of human OR10X1. Synthetic peptide located within the following region: NIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGSYHAHP
OR5T2 Rabbit Polyclonal Antibody
TA346243

USD 475.00

5 Days

Rabbit Polyclonal Anti-OR5T2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OR5T2 antibody: synthetic peptide directed towards the C terminal of human OR5T2. Synthetic peptide located within the following region: DMIVSIFYTIVIPLLNPVIYSLRNKDVKDSMKKMFGKNQVINKVYFHTKK
ADCY3 Rabbit Polyclonal Antibody
TA309564

USD 410.00

2 Weeks

Rabbit Polyclonal Adenylate Cyclase 3 Antibody

Applications IF, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Raised against a 20 amino acid peptide corresponding to the C-terminus of rat Adenylate Cyclase 3 (PAAFPNGSSVTLPHQVVDNP).
OR2C1 Rabbit Polyclonal Antibody
TA314307

USD 345.00

4 Weeks

Rabbit polyclonal anti-OR2C1 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR2C1.
OR2H3 (OR2H2) Rabbit Polyclonal Antibody
TA314707

USD 345.00

In Stock

Rabbit polyclonal anti-OR2H2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR2H2.