Rabbit Polyclonal Anti-Chst11 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Chst11 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Chst11. Synthetic peptide located within the following region: RMVLATCFGSFILVIFYFQSMLHPVMRRNPFGVDICCRKGSRSPLQELYN |
Rabbit Polyclonal Anti-Chst11 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Chst11 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: FEEFVAYLIDPHTQREEPFNEHWQTVYSLCHPCHIHYDLVGKYETLEEDS |
Germany
Japan
United Kingdom
China